Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kappa-type opioid receptor (OPRK1)

This Recombinant Human Kappa-type opioid receptor (OPRK1) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

Kappa-type opioid receptor, K-OR-1, KOR-1

UniProt

P41145

Expression Region

1-380

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV RNTVQDPAYLRDIDGMNKPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL
BNC040645-500 1x 500 µL

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF488A conjugate, 0.1mg/mL
BNC881052-500 1x 500 µL

CD3e (B-B12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-100 1x 100 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
BNC400012-500 1x 500 µL

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-100 1x 100 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details