Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apelin receptor (APLNR)

This Recombinant Human Apelin receptor (APLNR) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

Apelin receptor, Angiotensin receptor-like 1, G-protein coupled receptor APJ, G-protein coupled receptor HG11

UniProt

P35414

Expression Region

1-380

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREK RRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCL TGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQ CYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGL RKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYV NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGK GGEQMHEKSIPYSQETLVVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL17B/IL-17B Protein (Fc Tag)
PKSH033628-01 10 µg

Recombinant Human IL17B/IL-17B Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL17B/IL-17B Protein (Fc Tag)
PKSH033628-02 50 µg

Recombinant Human IL17B/IL-17B Protein (Fc Tag)

Sign In for Pricing
View Details
Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), 0.2mg/mL
BNUB1884-500 1x 500 µL

Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), 0.2mg/mL

Sign In for Pricing
View Details
DCX Polyclonal Antibody
E-AB-53390-01 20 µL

DCX Polyclonal Antibody

Sign In for Pricing
View Details
DCX Polyclonal Antibody
E-AB-53390-02 60 µL

DCX Polyclonal Antibody

Sign In for Pricing
View Details
DCX Polyclonal Antibody
E-AB-53390-03 120 µL

DCX Polyclonal Antibody

Sign In for Pricing
View Details