Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schistocerca gregaria Opsin-1 (Lo1)

This Recombinant Schistocerca gregaria Opsin-1 (Lo1) spans the amino acid sequence from region 1-381.

Product Specifications

Product Name Alternative

Opsin-1

UniProt

Q94741

Expression Region

1-381

Origin

Schistocerca gregaria (Desert locust)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASASLISEPSFSAYWGGSGGFANQTVVDKVPPEMLYLVDPHWYQFPPMNPLWHGLLGFV IGVLGVISVIGNGMVIYIFSTTKSLRTPSNLLVVNLAFSDFLMMFTMSAPMGINCYYETW VLGPFMCELYALFGSLFGCGSIWTMTMIALDRYNVIVKGLSAKPMTNKTAMLRILFIWAF SVAWTIMPLFGWNRYVPEGNMTACGTDYLTKDWVSRSYILVYSFFVYLLPLGTIIYSYFF ILQAVSAHEKQMREQRKKMNVASLRSAEASQTSAECKLAKVALMTISLWFFGWTPYLIIN FTGIFETMKISPLLTIWGSLFAKANAVFNPIVYGISHPKYRAALEKKFPSLACASSSDDN TSVASGATTVSDEKSEKSASA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin D (Tumor Marker) (CTSD/3275), CF594 conjugate, 0.1mg/mL
BNC943275-100 1x 100 µL

Cathepsin D (Tumor Marker) (CTSD/3275), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGLN1 / PHD2 (366G/76/3), CF405S conjugate, 0.1mg/mL
BNC043074-100 1x 100 µL

EGLN1 / PHD2 (366G/76/3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF647 conjugate, 0.1mg/mL
BNC472206-500 1x 500 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3093), Biotin conjugate, 0.1mg/mL
BNCB3093-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3093), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR pTyr869 Rabbit Polyclonal Antibody
AP20830PU-N 100 µg

EGFR pTyr869 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Protocadherin beta 12 (PCDHB12) (C-term) Rabbit Polyclonal Antibody
AP53207PU-N 400 µL

Protocadherin beta 12 (PCDHB12) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details