Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bombyx mori Ceropsin (Bcop)

This Recombinant Bombyx mori Ceropsin (Bcop) spans the amino acid sequence from region 1-381.

Product Specifications

Product Name Alternative

Ceropsin, Cerebral opsin, Boceropsin

UniProt

Q95YI3

Expression Region

1-381

Origin

Bombyx mori (Silk moth)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSISMDAGPGFAALQSWSSQVAAFGNSNQTVVDRVSPEMLHLIDAYWYQFPPMNPLWHAL LGFTIGVLGFISMMGNGMVIYIFMTTKNLKTPSNLLVVNLAFSDFLMMCAMSPAMVINCY NETWVFGPFACELYGCAGSLFGCASIWTMTMIAFDRYNVIVKGIAAKPMTNNGALLRILG IWAFSLAWTVAPFFGWNRYVPEGNMTACGTDYLTKDWFSRSYIVVYSVFVYFAPLLLIVY SYYYIVQAVSAHEKAMREQAKKMNVASLRSSEAANTSTECKLAKVALMTISLWFMAWTPY LVINYTGILESAPISPLATIWGSLFAKANAVYNPIVYGISHPKYQAALYKRFPVLQCHST TTDEASSVASGTTVMEEKPTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKAR1B (NM_001164762) Human Recombinant Protein
TP328862M 100 µg

PRKAR1B (NM_001164762) Human Recombinant Protein

Sign In for Pricing
View Details
Vmn2r51 Mouse Gene Knockout Kit (CRISPR)
KN519181 1 Kit

Vmn2r51 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF647 conjugate, 0.1mg/mL
BNC472250-100 1x 100 µL

Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (DCS-72.F6), CF594 conjugate, 0.1mg/mL
BNC940771-100 1x 100 µL

P27 / KIP1 (DCS-72.F6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARSF (NM_004042) Human Over-expression Lysate
LC401310 20 µg

ARSF (NM_004042) Human Over-expression Lysate

Sign In for Pricing
View Details
TNFAIP8 Recombinant Rabbit Monoclonal Antibody [JE65-07]
HA722580 100 µL

TNFAIP8 Recombinant Rabbit Monoclonal Antibody [JE65-07]

Sign In for Pricing
View Details