Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Sphingoid long-chain base transporter RSB1 (RSB1)

This Recombinant Saccharomyces cerevisiae Sphingoid long-chain base transporter RSB1 (RSB1) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Sphingoid long-chain base transporter RSB1

UniProt

C7GLH7

Expression Region

1-382

Origin

Saccharomyces cerevisiae (strain JAY291) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNATNNTLGSLLPQLEAAANSNSLYGGMVPNLRFNITMIVIWGILLTIHVVQLLMRQYW FSIAFICTGILEVLGFIGRTWSHSNVADMDAFLLNMICLTIAPVFTMGGIYYQLAKLIEV YGHRFSLLPSPMAYSFIFICSDIVSLVVQAVGGGLCGVAVTDGTSTTTGNHVFIAGLAIQ VASMAIFLMLWFHFLFRIYISVRWEHINSRPISLSLLKISQTEVDYLYREKFHFLRLEPK RWVFHYFNLAITVAVLTIFTRCCYRLAELVVGWDGYLITHEWYFIILDALMMAIATVTLT IFHPGFAFKGKSTSIPITPGHVDPETLPHTDDVEDILDTSDSKQFDIEKEEFQASMKYPI STFKQFMSKIANLFSSKKKAKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-100 1x 100 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
BNC400012-500 1x 500 µL

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
BNC880149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-500 1x 500 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-100 1x 100 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details