Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rutilus rutilus Opsin-VA

This Recombinant Rutilus rutilus Opsin-VA spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Opsin-VA, Vertebrate ancient opsin

UniProt

Q7T3Q7

Expression Region

1-382

Origin

Rutilus rutilus (Roach)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELFPVAVNGVSHAEDPFSGPLTFIAPWNYKVLATLMFVVTAASLSENFAVMLVTFRFTQ LRKPLNYIIVNLSLADFLVSLTGGTISFLTNYHGYFFLGKWACVLEGFAVTYFGIVALWS LAVLAFERFFVICRPLGNIRLRGKHAALGLLFVWTFSFIWTIPPVLGWSSYTVSKIGTTC EPNWYSGNFHDHTFIIAFFITCFILPLGVIVVCYCKLIKKLRKVSNTHGRLGNARKPERQ VTRMVVVMIVAFMVAWTPYAAFSIVVTAHPSIHLDPRLAAAPAFFSKTAAVYNPVIYVFM NKQFRKCLVQLLRCRDVTIIEGNINQTSERQGMTNESHTGEMSTIASRIPKDGSIPEKTQ EHPGERRSLAHIPIPENKVCPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Brucella Abortus rpmE Protein (aa 1-73)
VAng-Lsx5208-1mgEcoli 1 mg (E. coli)

Recombinant Brucella Abortus rpmE Protein (aa 1-73)

Sign In for Pricing
View Details
c-Jun Polyclonal Antibody
MBS191469 0.1 mg

c-Jun Polyclonal Antibody

Sign In for Pricing
View Details
SNTB2 (D16S2531E, SNT2B2, SNTL, Beta-2-syntrophin, Syntrophin-like, 59kD Dystrophin-associated Protein A1 Basic Component 2, Syntrophin-3, SNT2B2, SNT3, SNTL) (HRP)
MBS6155111-01 0.1 mL

SNTB2 (D16S2531E, SNT2B2, SNTL, Beta-2-syntrophin, Syntrophin-like, 59kD Dystrophin-associated Protein A1 Basic Component 2, Syntrophin-3, SNT2B2, SNT3, SNTL) (HRP)

Sign In for Pricing
View Details
SNTB2 (D16S2531E, SNT2B2, SNTL, Beta-2-syntrophin, Syntrophin-like, 59kD Dystrophin-associated Protein A1 Basic Component 2, Syntrophin-3, SNT2B2, SNT3, SNTL) (HRP)
MBS6155111-02 5x 0.1 mL

SNTB2 (D16S2531E, SNT2B2, SNTL, Beta-2-syntrophin, Syntrophin-like, 59kD Dystrophin-associated Protein A1 Basic Component 2, Syntrophin-3, SNT2B2, SNT3, SNTL) (HRP)

Sign In for Pricing
View Details
PDB4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
36253111 3x 1.0 µg

PDB4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ACHE Polyclonal Antibody, APC-Cy7 Conjugated
bs-2511R-APC-Cy7 100 µL

ACHE Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details