Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Prostacyclin receptor (PTGIR)

This Recombinant Bovine Prostacyclin receptor (PTGIR) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Prostacyclin receptor, Prostaglandin I2 receptor, PGI receptor, PGI2 receptor, Prostanoid IP receptor

UniProt

P79393

Expression Region

1-382

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADSCRNLTYVRDSVGPATSTLMFVAGVVGNGLALGILGARRHSRPSAFAVLVTGLGVTD LLGTCFLSPAVFAAYARNSSLLGLARGRPALCDAFAFAMTFFGLASTLILFAMAVERCLA LSHPYLYAQLDGPRRARLALPAIYAFCTIFCSLPFLGLGQHQQYCPGSWCFIRMRSAEPG GCAFLLAYASLVALLVAAIVLCNGSVTLSLCRMYRQQRRHQARCPRPRAGEDEVDHLILL ALMTGIMAVCSLPLTPQIRGFTQAIAPDSSEMGDLLAFRFNAFNPILDPWVFILFRKSVF QRLKLWFCCLYSRPAQGDSRTSLSQSASGRKDSSAPPALEGKKGNWVPLSAWGEGQGGPL PAVQLPTSTVGTPSKAGSEAAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-500 1x 500 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF405S conjugate, 0.1mg/mL
BNC040151-100 1x 100 µL

CD11a (Cris-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
BNC940149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/1778), CF488A conjugate, 0.1mg/mL
BNC881778-100 1x 100 µL

Spectrin beta III (SPTBN2) (SPTBN2/1778), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNA Ligase 1 (1A9), CF640R conjugate, 0.1mg/mL
BNC402177-500 1x 500 µL

DNA Ligase 1 (1A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/1131), CF640R conjugate, 0.1mg/mL
BNC401131-100 1x 100 µL

CD45RA (PTPRC/1131), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details