Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuropeptide Y receptor type 1 (Npy1r)

This Recombinant Mouse Neuropeptide Y receptor type 1 (Npy1r) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 1, NPY1-R

UniProt

Q04573

Expression Region

1-382

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTLFSKVENHSIHYNASENSPLLAFENDDCHLPLAVIFTLALAYGAVIILGVSGNLAL IIIILKQKEMRNVTNILIVNLSFSDLLVAVMCLPFTFVYTLMDHWVFGETMCKLNPFVQC VSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYIGITVIWVLAVASSLPFVIYQILTD EPFQNVSLAAFKDKYVCFDKFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRR NNMMDKIRDSKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLL FLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSK TSLKQASPVAFKKISMNDNEKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crk-L Polyclonal Antibody
BT-AP02235-01 20 µL

Crk-L Polyclonal Antibody

Sign In for Pricing
View Details
Crk-L Polyclonal Antibody
BT-AP02235-02 50 µL

Crk-L Polyclonal Antibody

Sign In for Pricing
View Details
Crk-L Polyclonal Antibody
BT-AP02235-03 100 µL

Crk-L Polyclonal Antibody

Sign In for Pricing
View Details
TBC1D24 Rabbit Polyclonal Antibody
orb631737-01 50 µg

TBC1D24 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TBC1D24 Rabbit Polyclonal Antibody
orb631737-02 100 µg

TBC1D24 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fragile X mental retardation 1 neighbor protein
orb1645173-01 50 µg

Fragile X mental retardation 1 neighbor protein

Sign In for Pricing
View Details