Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sphingosine 1-phosphate receptor 1 (S1pr1)

This Recombinant Mouse Sphingosine 1-phosphate receptor 1 (S1pr1) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Sphingosine 1-phosphate receptor 1, S1P receptor 1, S1P1, Endothelial differentiation G-protein coupled receptor 1, Lysophospholipid receptor B1, Sphingosine 1-phospha

UniProt

O08530

Expression Region

1-382

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSTSIPEVKALRSSVSDYGNYDIIVRHYNYTGKLNIGAEKDHGIKLTSVVFILICCFII LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPIM GWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVLA VLNSGTNPIIYTLTNKEMRRAFIRIVSCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSSH PQKDDGDNPETIMSSGNVNSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pure Homarus americanus Lectin (California lobster) -HMA-
L-6201-1 1 mg

Pure Homarus americanus Lectin (California lobster) -HMA-

Sign In for Pricing
View Details
PKN2 Mouse Monoclonal Antibody [Clone ID: 1D1]
AM06663SU-N 100 µL

PKN2 Mouse Monoclonal Antibody [Clone ID: 1D1]

Sign In for Pricing
View Details
Hist2h2bb (BC019122) Mouse Tagged ORF Clone
MG200575 10 µg

Hist2h2bb (BC019122) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Slc4a4 Mouse Gene Knockout Kit (CRISPR)
KN316144LP 1 Kit

Slc4a4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS710051 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Recombinant Rad51 Monoclonal Antibody
AN301776L-01 50 µL

Recombinant Rad51 Monoclonal Antibody

Sign In for Pricing
View Details