Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sphingosine 1-phosphate receptor 1 (S1pr1)

This Recombinant Mouse Sphingosine 1-phosphate receptor 1 (S1pr1) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Sphingosine 1-phosphate receptor 1, S1P receptor 1, S1P1, Endothelial differentiation G-protein coupled receptor 1, Lysophospholipid receptor B1, Sphingosine 1-phospha

UniProt

O08530

Expression Region

1-382

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSTSIPEVKALRSSVSDYGNYDIIVRHYNYTGKLNIGAEKDHGIKLTSVVFILICCFII LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPIM GWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVLA VLNSGTNPIIYTLTNKEMRRAFIRIVSCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSSH PQKDDGDNPETIMSSGNVNSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-500 1x 500 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF640R conjugate, 0.1mg/mL
BNC402052-500 1x 500 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2423), CF647 conjugate, 0.1mg/mL
BNC472423-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2423), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), Biotin conjugate, 0.1mg/mL
BNCB0096-100 1x 100 µL

Histone H1 (AE-4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details