Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Chemokine-binding protein 2 (Ccbp2)

This Recombinant Rat Chemokine-binding protein 2 (Ccbp2) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Chemokine-binding protein 2, C-C chemokine receptor D6, CCR10-related receptor, Chemokine-binding protein D6

UniProt

O09027

Expression Region

1-382

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTIASPLPLATTGPENGSSIYDYDYLDDVTVLVCSKDEVLSFGRVFLPVVYSLIFVLGL AGNLLLLVVLLHSVPQRRRMIELYLLNLAVSNLLFVVTMPFWAISVAWHWVFGSFLCKVV STLYSINFYCGIFFITCMSLDKYLEIVHAQPLHRPKTRFRNLLLIVMVWITALAVSVPEM VFVKVHQTLDGVWHCYADFGGHATIWKLYLRFQMNLLGFLFPLLAMIFFYSRIGCVLVRL RPPGQGRALRMAAALVVVFFLLWFPYNLTLFLHSLLDLHVFGNCKISHRLDYMLQVTESL AFSHCCFTPVLYAFSSHSFRQYLKAVLSVVLRRHQAPGTAHAPPCSHSESSRVTAQEDVV SMNDLGERQADISLNKGEIGNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear Factor 1 (NFIA) Mouse Monoclonal Antibody [Clone ID: OTI4G7]
CF811198 100 µg

Nuclear Factor 1 (NFIA) Mouse Monoclonal Antibody [Clone ID: OTI4G7]

Sign In for Pricing
View Details
PAPSS2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7E8]
TA807112BM 100 µL

PAPSS2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7E8]

Sign In for Pricing
View Details
SLIT3 Rabbit Polyclonal Antibody
TA367275 100 µL

SLIT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BPGM (C-term) Rabbit Polyclonal Antibody
AP50385PU-N 400 µL

BPGM (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glypican-3 (1G12), Biotin conjugate, 0.1mg/mL
BNCB0862-100 1x 100 µL

Glypican-3 (1G12), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Amino-2-furancarboxylic Acid Hydrochloride
TRC-A609680-1MG 1 mg

4-Amino-2-furancarboxylic Acid Hydrochloride

Sign In for Pricing
View Details