Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Sphingosine 1-phosphate receptor 1 (S1pr1)

This Recombinant Rat Sphingosine 1-phosphate receptor 1 (S1pr1) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Sphingosine 1-phosphate receptor 1, S1P receptor 1, S1P1, Endothelial differentiation G-protein coupled receptor 1, Sphingosine 1-phosphate receptor Edg-1

UniProt

P48303

Expression Region

1-383

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSSTSIPVVKALRSQVSDYGNYDIIVRHYNYTGKLNIGVEKDHGIKLTSVVFILICCLI ILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFL REGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPI MGWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRK NISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVL AVLNSGTNPIIYTLTNKEMRRAFIRIISCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSS HPQKDDGDNPETIMSSGNVNSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL
BNC040669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-100 1x 100 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-500 1x 500 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL
BNC940031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details