Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila virilis Opsin Rh4 (Rh4)

This Recombinant Drosophila virilis Opsin Rh4 (Rh4) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Opsin Rh4, Inner R7 photoreceptor cells opsin

UniProt

P17646

Expression Region

1-383

Origin

Drosophila virilis (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIAGSLCNASEGPVLRPEARVSGNGDLQFLGWNVPPDQIQHIPEHWLTQLEPPASMHYM LGVFYIFLFCASTVGNGMVIWIFSTSKALRTPSNMFVLNLAVFDFIMCLKAPIFIYNSFH RGFALGNTGCQIFAAIGSYSGIGAGMTNAAIGYDRLNVITKPMNRNMTFTKAIIMNVIIW LYCTPWVVLPLTQFWDRFVPEGYLTSCTFDYLTDNFDTRLFVGTIFFFSFVCPTLMIIYY YSQIVGHVFSHEKALREQAKKMNVESLRSNVDKSKDTAEIRIAKAAITICFLFFVSWTPY GVMSLIGAFGDKSLLTPGATMIPACTCKLVACIDPFVYAISHPRYRMELQKRCPWLAIDE KAPESSSAASTTTTQEQQQTTAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
BNC940181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL
BNC680437-500 1x 500 µL

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF594 conjugate, 0.1mg/mL
BNC941373-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (PASE/4LJ), CF488A conjugate, 0.1mg/mL
BNC881473-500 1x 500 µL

Prostate Specific Acid Phosphatase (PSAP) (PASE/4LJ), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF640R conjugate, 0.1mg/mL
BNC401917-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details