Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prokineticin receptor 2 (PROKR2)

This Recombinant Human Prokineticin receptor 2 (PROKR2) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Prokineticin receptor 2, PK-R2, G-protein coupled receptor 73-like 1, GPR73b, GPRg2

UniProt

Q8NFJ6

Expression Region

1-384

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIAL AGIMLVCGIGNFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLS WEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMV SILIAIPSAYFATETVLFIVKSQEKIFCGQIWPVDQQLYYKSYFLFIFGVEFVGPVVTMT LCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF FPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNNTMKYFKKMMLLHWRPSQRGSK SSADLDLRTNGVPTTEEVDCIRLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S137 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
39693061 1.0 µg DNA

RN5S137 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
GRK7 (NM_139209) Human Over-expression Lysate
LC408355 20 µg

GRK7 (NM_139209) Human Over-expression Lysate

Sign In for Pricing
View Details
STAM2 Overexpression Lysate (Native) - (Dry Ice)
NBL1-16510 0.1 mg

STAM2 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
rno-miR-6322 Primers
MPR00788 150 µL - 10 µM

rno-miR-6322 Primers

Sign In for Pricing
View Details
VWA3A Recombinant Protein Antigen
NBP1-93775PEP 0.1 mL

VWA3A Recombinant Protein Antigen

Sign In for Pricing
View Details
Rabbit Anti-phospho-CRK (Ser41) antibody
SL5264R-01 50 µL

Rabbit Anti-phospho-CRK (Ser41) antibody

Sign In for Pricing
View Details