Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prokineticin receptor 2 (PROKR2)

This Recombinant Human Prokineticin receptor 2 (PROKR2) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Prokineticin receptor 2, PK-R2, G-protein coupled receptor 73-like 1, GPR73b, GPRg2

UniProt

Q8NFJ6

Expression Region

1-384

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIAL AGIMLVCGIGNFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLS WEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMV SILIAIPSAYFATETVLFIVKSQEKIFCGQIWPVDQQLYYKSYFLFIFGVEFVGPVVTMT LCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF FPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNNTMKYFKKMMLLHWRPSQRGSK SSADLDLRTNGVPTTEEVDCIRLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pig EGF Protein, N-GST & C-His
orb2831096-01 20 µg

Recombinant Pig EGF Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Pig EGF Protein, N-GST & C-His
orb2831096-02 50 µg

Recombinant Pig EGF Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Pig EGF Protein, N-GST & C-His
orb2831096-03 100 µg

Recombinant Pig EGF Protein, N-GST & C-His

Sign In for Pricing
View Details
KMO Protein Vector (Human) (pPB-C-His)
PV023049 500 ng

KMO Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
ATP5J2P2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
12745151 3x 1.0 µg DNA

ATP5J2P2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
CGB1 Rabbit Polyclonal Antibody
MBS9513829-01 0.05 mL

CGB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details