Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Prokineticin receptor 2 (PROKR2)

This Recombinant Bovine Prokineticin receptor 2 (PROKR2) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Prokineticin receptor 2, PK-R2, G-protein coupled receptor 73-like 1, G-protein coupled receptor I5E

UniProt

Q8SPN1

Expression Region

1-384

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAQNGNASFPANFSIPQEHASSLPFNFSYDDYDLPLDEDEDMTKTQTFFAAKIVIGVAL VGIMLTCGIGNFVFITALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVHQLS WEHGHVLCACINYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMV SILISIPSAYFTKETVLFIVKNQKKIFCGQVWPVDQQLYYKSYFLFVFGIEFLGPVFTMT LCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF FPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNSTMKYFKKMLLLHWRPSHHGSK SSADLDLKTSRLPATEEVDCIRLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
BNC470745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
BNC041045-100 1x 100 µL

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PS2 (TFF1/1091), CF647 conjugate, 0.1mg/mL
BNC471091-100 1x 100 µL

PS2 (TFF1/1091), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-100 1x 100 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details