Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 88 (Gpr88)

This Recombinant Mouse Probable G-protein coupled receptor 88 (Gpr88) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 88, Striatum-specific G-protein coupled receptor

UniProt

Q9EPB7

Expression Region

1-384

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNSSSTSTSTTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFR KLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPSGSAEPPGDWDGGGGSYRLLRGGLL GLGLTVSLLSHCLVALNRYLLITRAPATYQVLYQRRHTVGMLALSWALALGLVLLLPPWA PKPGAEPPQVHYPALLAAGALLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGC AAAAAAFPAAPHAPGPGGAAHPAQPQPLPAALQPRRAQRRLSGLSVLLLCCVFLLATQPL VWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSVLPGVGDAAAA AAAATAVPAMSQAQLGTRAAGQHW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Calcium-regulated heat stable protein 1 (CARHSP1) ELISA Kit
MBS7200374-01 48 Well

Canine Calcium-regulated heat stable protein 1 (CARHSP1) ELISA Kit

Sign In for Pricing
View Details
Canine Calcium-regulated heat stable protein 1 (CARHSP1) ELISA Kit
MBS7200374-02 96 Well

Canine Calcium-regulated heat stable protein 1 (CARHSP1) ELISA Kit

Sign In for Pricing
View Details
Canine Calcium-regulated heat stable protein 1 (CARHSP1) ELISA Kit
MBS7200374-03 5x 96 Well

Canine Calcium-regulated heat stable protein 1 (CARHSP1) ELISA Kit

Sign In for Pricing
View Details
Canine Calcium-regulated heat stable protein 1 (CARHSP1) ELISA Kit
MBS7200374-04 10x 96 Well

Canine Calcium-regulated heat stable protein 1 (CARHSP1) ELISA Kit

Sign In for Pricing
View Details
IKKγ (S31) polyclonal antibody
AP0640-01 50 µL

IKKγ (S31) polyclonal antibody

Sign In for Pricing
View Details
IKKγ (S31) polyclonal antibody
AP0640-02 100 µL

IKKγ (S31) polyclonal antibody

Sign In for Pricing
View Details