Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Substance-K receptor (TACR2)

This Recombinant Rabbit Substance-K receptor (TACR2) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Substance-K receptor, SKR, NK-2 receptor, NK-2R, Neurokinin A receptor, Tachykinin receptor 2

UniProt

P79218

Expression Region

1-384

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGACDIVTEANISSDIDSNATGVTAFSMPGWQLALWATAYLALVLVAVVGNATVIWIILA HRRMRTVTNYFIVNLALADLCMATFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAADRYMAIVHPFQPRLSGPGTKAVIAGIWLVALALAFPQCFYSTITMDQGATK CVVAWPEDSGGKMLLLYHLTVIALIYFLPLVVMFVAYSVIGFKLWRRTVPGHQTHGANLR HLRAKKKFVKTMVLVVVTFAVCWLPYHLYFLLGHFQDDIYCRKFIQQVYLVLFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDKLELTHTPSLSVRVNRCHTKETLFLV GDVAPSEAANGQAGGPQDGGAYDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRMT6 Mouse Monoclonal Antibody [Clone ID: 4G2]
AM06482SU-N 100 µL

PRMT6 Mouse Monoclonal Antibody [Clone ID: 4G2]

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/1844), CF647 conjugate, 0.1mg/mL
BNC471844-100 1x 100 µL

CD79b (B-Cell Marker) (IGB/1844), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/2756R), CF740 conjugate, 0.1mg/mL
BNC742756-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/2756R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human XAGE1 (XAGE1E) activation kit by CRISPRa
GA118818 1 Kit

Human XAGE1 (XAGE1E) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: right
CS805990 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details
Human FBXO36 activation kit by CRISPRa
GA115130 1 Kit

Human FBXO36 activation kit by CRISPRa

Sign In for Pricing
View Details