Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Substance-K receptor (TACR2)

This Recombinant Rabbit Substance-K receptor (TACR2) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Substance-K receptor, SKR, NK-2 receptor, NK-2R, Neurokinin A receptor, Tachykinin receptor 2

UniProt

P79218

Expression Region

1-384

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGACDIVTEANISSDIDSNATGVTAFSMPGWQLALWATAYLALVLVAVVGNATVIWIILA HRRMRTVTNYFIVNLALADLCMATFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAADRYMAIVHPFQPRLSGPGTKAVIAGIWLVALALAFPQCFYSTITMDQGATK CVVAWPEDSGGKMLLLYHLTVIALIYFLPLVVMFVAYSVIGFKLWRRTVPGHQTHGANLR HLRAKKKFVKTMVLVVVTFAVCWLPYHLYFLLGHFQDDIYCRKFIQQVYLVLFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDKLELTHTPSLSVRVNRCHTKETLFLV GDVAPSEAANGQAGGPQDGGAYDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tryptophanyl tRNA synthetase/WRS Antibody
OC-424-01 50 μL

Tryptophanyl tRNA synthetase/WRS Antibody

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase/WRS Antibody
OC-424-02 100 µL

Tryptophanyl tRNA synthetase/WRS Antibody

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase/WRS Antibody
OC-424-03 1 mL

Tryptophanyl tRNA synthetase/WRS Antibody

Sign In for Pricing
View Details
DUSP19 Human qPCR Primer Pair (NM_080876)
HP216787 200 Reactions

DUSP19 Human qPCR Primer Pair (NM_080876)

Sign In for Pricing
View Details
Medium Water Purification System BDPS-206
BDPS-206 1 Unit

Medium Water Purification System BDPS-206

Sign In for Pricing
View Details
RNF135 (NM_032322) Human Recombinant Protein
TP319438M 100 µg

RNF135 (NM_032322) Human Recombinant Protein

Sign In for Pricing
View Details