Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Substance-K receptor (TACR2)

This Recombinant Rabbit Substance-K receptor (TACR2) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Substance-K receptor, SKR, NK-2 receptor, NK-2R, Neurokinin A receptor, Tachykinin receptor 2

UniProt

P79218

Expression Region

1-384

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGACDIVTEANISSDIDSNATGVTAFSMPGWQLALWATAYLALVLVAVVGNATVIWIILA HRRMRTVTNYFIVNLALADLCMATFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAADRYMAIVHPFQPRLSGPGTKAVIAGIWLVALALAFPQCFYSTITMDQGATK CVVAWPEDSGGKMLLLYHLTVIALIYFLPLVVMFVAYSVIGFKLWRRTVPGHQTHGANLR HLRAKKKFVKTMVLVVVTFAVCWLPYHLYFLLGHFQDDIYCRKFIQQVYLVLFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDKLELTHTPSLSVRVNRCHTKETLFLV GDVAPSEAANGQAGGPQDGGAYDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF647 conjugate, 0.1mg/mL
BNC472302-100 1x 100 µL

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RNF144 (RNF144A) Rabbit Polyclonal Antibody
TA380977 100 µL

RNF144 (RNF144A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR4K14 (NM_001004712) Human Over-expression Lysate
LY423898 100 µg

OR4K14 (NM_001004712) Human Over-expression Lysate

Sign In for Pricing
View Details
MTRNR2L1 Human Gene Knockout Kit (CRISPR)
KN430903 1 Kit

MTRNR2L1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD19 Antibody[CB19]
E-AB-F1004L-01 20 Tests

Elab Fluor® 488 Anti-Human CD19 Antibody[CB19]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD19 Antibody[CB19]
E-AB-F1004L-02 100 Tests

Elab Fluor® 488 Anti-Human CD19 Antibody[CB19]

Sign In for Pricing
View Details