Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Substance-K receptor (Tacr2)

This Recombinant Mouse Substance-K receptor (Tacr2) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Substance-K receptor, SKR, NK-2 receptor, NK-2R, Neurokinin A receptor, Tachykinin receptor 2

UniProt

P30549

Expression Region

1-384

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAHASVTDTNILSGLESNATGVTAFSMPGWQLALWATAYLALVLVAVTGNATVIWIILA HERMRTVTNYFIINLALADLCMAAFNATFNFIYASHNIWYFGSTFCYFQNLFPVTAMFVS IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAVIWLVALALASPQCFYSTITVDQGATK CVVAWPNDNGGKMLLLYHLVVFVLIYFLPLVVMFAAYSVIGLTLWKRAVPRHQAHGANLR HLQAKKKFVKAMVLVVVTFAICWLPYHLYFILGTFQEDIYYRKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWGTPTEEDRLELTHTPSISRRVNRCHTKETLFMT GDMTHSEATNGQVGGPQDGEPAGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBA2 Human Gene Knockout Kit (CRISPR)
KN401288 1 Kit

UBA2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD276 Recombinant Rabbit Monoclonal Antibody [PD00-36]
HA721245 100 µL

CD276 Recombinant Rabbit Monoclonal Antibody [PD00-36]

Sign In for Pricing
View Details
ASF1B Mouse Monoclonal Antibody [Clone ID: OTI4A4]
CF813137 100 µg

ASF1B Mouse Monoclonal Antibody [Clone ID: OTI4A4]

Sign In for Pricing
View Details
Recombinant Human CXCL12/SDF-1 Protein (aa22-89)
PKSH032296-01 10 µg

Recombinant Human CXCL12/SDF-1 Protein (aa22-89)

Sign In for Pricing
View Details
Recombinant Human CXCL12/SDF-1 Protein (aa22-89)
PKSH032296-02 50 µg

Recombinant Human CXCL12/SDF-1 Protein (aa22-89)

Sign In for Pricing
View Details
HSPA1L Mouse Monoclonal Antibody [Clone ID: OTI2H3]
CF812115 100 µg

HSPA1L Mouse Monoclonal Antibody [Clone ID: OTI2H3]

Sign In for Pricing
View Details