Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Substance-K receptor (Tacr2)

This Recombinant Mouse Substance-K receptor (Tacr2) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Substance-K receptor, SKR, NK-2 receptor, NK-2R, Neurokinin A receptor, Tachykinin receptor 2

UniProt

P30549

Expression Region

1-384

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAHASVTDTNILSGLESNATGVTAFSMPGWQLALWATAYLALVLVAVTGNATVIWIILA HERMRTVTNYFIINLALADLCMAAFNATFNFIYASHNIWYFGSTFCYFQNLFPVTAMFVS IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAVIWLVALALASPQCFYSTITVDQGATK CVVAWPNDNGGKMLLLYHLVVFVLIYFLPLVVMFAAYSVIGLTLWKRAVPRHQAHGANLR HLQAKKKFVKAMVLVVVTFAICWLPYHLYFILGTFQEDIYYRKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWGTPTEEDRLELTHTPSISRRVNRCHTKETLFMT GDMTHSEATNGQVGGPQDGEPAGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B2 (X29.2), CF488A conjugate, 0.1mg/mL
BNC883059-500 1x 500 µL

Cyclin B2 (X29.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Weighing Scale BBAL-419
BBAL-419 1 Unit

Weighing Scale BBAL-419

Sign In for Pricing
View Details
DDIT3 Rabbit Polyclonal Antibody
TA375372 100 µL

DDIT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SFMBT1 (NM_016329) Human Over-expression Lysate
LC402540 20 µg

SFMBT1 (NM_016329) Human Over-expression Lysate

Sign In for Pricing
View Details
ADI1 (NM_018269) Human Over-expression Lysate
LY402662 100 µg

ADI1 (NM_018269) Human Over-expression Lysate

Sign In for Pricing
View Details
CORO1C Polyclonal Antibody
E-AB-11096-01 20 µL

CORO1C Polyclonal Antibody

Sign In for Pricing
View Details