Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Somatostatin receptor type 4 (Sstr4)

This Recombinant Mouse Somatostatin receptor type 4 (Sstr4) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Somatostatin receptor type 4, SS-4-R, SS4-R, SS4R

UniProt

P49660

Expression Region

1-384

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNAPATLLRGVEDTTWTPGINASWAPEQEEDAMGSDGTGTAGMVTIQCIYALVCLVGLVG NALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVRSAAALRHWPFGAVLCRAVLS VDGLNMFTSVFCLTVLSVDRYVAVVHPLRTATYRRPSVAKLINLGVWLASLLVTLPIAVF ADTRPARGGEAVACNLHWPHPAWSAVFVIYTFLLGFLPPVLAIGLCYLLIVGKMRAVALR GGWQQRRRSEKKITRLVLMVVTVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILSYANS CANPILYGFLSDNFRRSFQRVLCLRCCLLETTGGAEEEPLDYYATALKSRGGAGCICPPL PCQQEPVQAEPGCKQVPFTKTTTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTLA4 Antibody
KC-293-01 50 μL

CTLA4 Antibody

Sign In for Pricing
View Details
CTLA4 Antibody
KC-293-02 100 µL

CTLA4 Antibody

Sign In for Pricing
View Details
CTLA4 Antibody
KC-293-03 1 mL

CTLA4 Antibody

Sign In for Pricing
View Details
CD63 (LAMP3/968), Biotin conjugate, 0.1mg/mL
BNCB0968-100 1x 100 µL

CD63 (LAMP3/968), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eotaxin 2 (CCL24) Human Gene Knockout Kit (CRISPR)
KN420724 1 Kit

Eotaxin 2 (CCL24) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C2CD4B Human Gene Knockout Kit (CRISPR)
KN422640 1 Kit

C2CD4B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details