Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Urotensin-2 receptor (UTS2R)

This Recombinant Bovine Urotensin-2 receptor (UTS2R) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Urotensin-2 receptor, UR-2-R, G-protein coupled receptor 14, G-protein coupled sensory epithelial neuropeptide-like receptor, SENR, Urotensin II receptor, Short nam

UniProt

P49220

Expression Region

1-384

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALSPEPSSRFLVPATMGSAMPELPGAPNASLNSSLASPTEPNSLEDLVATGTIGVVLSA MGVVGMAGNVYTLTVMCRFLHTSASMYVYVINLALADLLYLLSIPFIVATYVTKRWHFGD VGCRVLFSLDFLTMHASIFTLTLMSRERYAAVVRPLDTVQRSKGYRKVLALGTWLLALLL ALPMMLAIRLVRRGHKSLCLPAWGQRTHRAYLTLLFGTSIVGPGVVIGLLYVRLARAYWL SQRSSFTQTRRLPNPRVLYLILGIVLLFWACFLPFWLWQLLAQYRGAPPLAPRSARIVNY LTTCLTYGNSCVNPFLYTLLTKNYRDYRQRSLHSRGTSGPVGVRSFPQGHTRCQLGSGRS VTSSSQQATETIALSQAVPGSLCV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-500 1x 500 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-500 1x 500 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-100 1x 100 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details