Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sphingosine 1-phosphate receptor 4 (S1PR4)

This Recombinant Human Sphingosine 1-phosphate receptor 4 (S1PR4) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Sphingosine 1-phosphate receptor 4, S1P receptor 4, S1P4, Endothelial differentiation G-protein coupled receptor 6, Sphingosine 1-phosphate receptor Edg-6

UniProt

O95977

Expression Region

1-384

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS FRGSRSLSFRMREPLSSISSVRSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LysoBrite™ Green DND-26
22648-AAT 500 Tests

LysoBrite™ Green DND-26

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2466), 0.2mg/mL
BNUB2466-500 1x 500 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2466), 0.2mg/mL

Sign In for Pricing
View Details
BCKDH kinase (BCKDK) (NM_005881) Human Over-expression Lysate
LC401780 20 µg

BCKDH kinase (BCKDK) (NM_005881) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS806545 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) Rabbit Polyclonal Antibody
AP17525PU-N 400 µL

Cytokeratin 10 (KRT10) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
τ-Fluvalinate (Mixture of 2 Diastereomers)
TRC-F601100-25MG 25 mg

τ-Fluvalinate (Mixture of 2 Diastereomers)

Sign In for Pricing
View Details