Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Elephas maximus Alpha-2B adrenergic receptor (ADRA2B)

This Recombinant Elephas maximus Alpha-2B adrenergic receptor (ADRA2B) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Alpha-2B adrenergic receptor, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR

UniProt

O19014

Expression Region

1-384

Origin

Elephas maximus (Indian elephant)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALQYNSKRTPRRIKCVI LTVWLIAAAISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILSSSIGSFFAPCLIMILVYL RIYLIAKRSNRRGPRAKGAPREGEPKQPHPLPAGPSALANSPTLASSLAVTGEANGHSEP PGEKERETPEDPGTLTLPPSWPVLPNSGQGQKEGVCGASPEEEEECGSPAVPASPALACS PPLQQPKGSRVLATLRGQVLLGRGVGTAGGQWWRRRAQLTREKRFTFVLAVVIGVFVLCW FPFFFSYSLGAICPQHCKVPHGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
AP02636PU-S 50 µL

beta Catenin (CTNNB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CF®647 Rabbit Anti-HA (Hemagglutinin) IgG,1 mg/mL
#20486 1x 50 µL

CF®647 Rabbit Anti-HA (Hemagglutinin) IgG,1 mg/mL

Sign In for Pricing
View Details
EZH1 (NM_001991) Human Over-expression Lysate
LY419594 100 µg

EZH1 (NM_001991) Human Over-expression Lysate

Sign In for Pricing
View Details
CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), CF594 conjugate, 0.1mg/mL
BNC942394-500 1x 500 µL

CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoGEF (PLEKHG6) (NM_001144857) Human Over-expression Lysate
LY428529 100 µg

MyoGEF (PLEKHG6) (NM_001144857) Human Over-expression Lysate

Sign In for Pricing
View Details
ATP5F1B (NM_001686) Human Over-expression Lysate
LC400637 20 µg

ATP5F1B (NM_001686) Human Over-expression Lysate

Sign In for Pricing
View Details