Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Echinops telfairi Alpha-2B adrenergic receptor (ADRA2B)

This Recombinant Echinops telfairi Alpha-2B adrenergic receptor (ADRA2B) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Alpha-2B adrenergic receptor, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR

UniProt

O77723

Expression Region

1-384

Origin

Echinops telfairi (Lesser hedgehog tenrec)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AIAAVTTFLILFTVFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIXPFSLANE LLGYWYFWHTWCEVYLALXVLXCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIXGII LTVWLIAAAISLPPLIYKGDQGPQPHGRPQCRLNQEAWYILSSSIGSFFAPCLIMILVYL RIYLIAKRRNRRGPRAQGASKGGASKQPHPLAGGASTKPPTLTSSLAVAGEVNGHSKPTG QEGKTPEDLGVVTLPPNWPALPNSGQGQKEGVCGISPEXAEEEEEGGPEALPASPASXGS PQLQQPQGTRVLVTLRGQVVLSRGLGAASGQWWRRRTQLTREKRFTFVLAVVIGVXVLCW FPFFXSYSLGAICPQHCTVXHGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERG Recombinant Rabbit monoclonal Antibody [SP06-04]
ET1604-21-50UL 50 µL

ERG Recombinant Rabbit monoclonal Antibody [SP06-04]

Sign In for Pricing
View Details
(R)-2-((4-Aminophenethyl)amino)-1-phenylethanol Hydrochloride
TRC-A622675-5G 5 g

(R)-2-((4-Aminophenethyl)amino)-1-phenylethanol Hydrochloride

Sign In for Pricing
View Details
S2P (MBTPS2) Human Gene Knockout Kit (CRISPR)
KN418791 1 Kit

S2P (MBTPS2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ENTPD3 (NM_001248) Human Over-expression Lysate
LC400499 20 µg

ENTPD3 (NM_001248) Human Over-expression Lysate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Swine IgG,  15nm
GAF-471-15 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Swine IgG, 15nm

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS507705 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details