Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Manduca sexta Opsin-3 (OP3)

This Recombinant Manduca sexta Opsin-3 (OP3) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Opsin-3, MANOP3, Rhodopsin 3, short-wavelength, Rhodopsin P450

UniProt

O96107

Expression Region

1-384

Origin

Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATNFTQELYEIGPMAYPLKMISKDVAEHMLGWNIPEEHQDLVHDHWRNFPAVSKYWHYV LALIYTMLMVTSLTGNGIVIWIFSTSKSLRSASNMFVINLAVFDLMMMLEMPLLIMNSFY QRLVGYQLGCDVYAVLGSLSGIGGAITNAVIAFDRYKTISSPLDGRINTVQAGLLIAFTW FWALPFTILPAFRIWGRFVPEGFLTTCSFDYFTEDQDTEVFVACIFVWSYCIPMALICYF YSQLFGAVRLHERMLQEQAKKMNVKSLASNKEDNSRSVEIRIAKVAFTIFFLFICAWTPY AFVTMTGAFGDRTLLTPIATMIPAVCCKVVSCIDPWVYAINHPRYRAELQKRLPWMGVRE QDPDAVSTTTSVATAGFQPPAAEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM42 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
38634064 1.0 µg DNA

RBM42 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MYL7 Protein Vector (Human) (pPB-C-His)
PV027357 500 ng

MYL7 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
S2P Rabbit Polyclonal Antibody
E28PT4205 100 µL

S2P Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ENO2 antibody
FNab05867 100 µg

ENO2 antibody

Sign In for Pricing
View Details
Mouse Anti-Human IgA - AcalephFluor488
CSA3234-01 100 µL

Mouse Anti-Human IgA - AcalephFluor488

Sign In for Pricing
View Details
Mouse Anti-Human IgA - AcalephFluor488
CSA3234-02 500 μL

Mouse Anti-Human IgA - AcalephFluor488

Sign In for Pricing
View Details