Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Odorant receptor 33c (Or33c)

This Recombinant Drosophila melanogaster Odorant receptor 33c (Or33c) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Odorant receptor 33c

UniProt

P81916

Expression Region

1-384

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVIIDSLSFYRPFWICMRLLVPTFFKDSSRPVQLYVVLLHILVTLWFPLHLLLHLLLLPS TAEFFKNLTMSLTCVACSLKHVAHLYHLPQIVEIESLIEQLDTFIASEQEHRYYRDHVHC HARRFTRCLYISFGMIYALFLFGVFVQVISGNWELLYPAYFPFDLESNRFLGAVALGYQV FSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQLGYFDDETVVNHQRLLDYIEQHK LLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLFFVGDTISLVYYLVFFGVVCVQLF PSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQLTLGNRGWIIKAGGLIELN LNAFFATLKMAYSLFAVVVRAKGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
BNC740676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), CF640R conjugate, 0.1mg/mL
BNC402419-100 1x 100 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26), CF555 conjugate, 0.1mg/mL
BNC550020-500 1x 500 µL

Cytokeratin 19 (A53-B/A2.26), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ku-Holo (p70;83) (KU729), CF405S conjugate, 0.1mg/mL
BNC040729-500 1x 500 µL

Ku-Holo (p70;83) (KU729), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details