Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Integral membrane protein GPR137B (Gpr137b)

This Recombinant Mouse Integral membrane protein GPR137B (Gpr137b) spans the amino acid sequence from region 1-385.

Product Specifications

Product Name Alternative

Integral membrane protein GPR137B, Transmembrane 7 superfamily member 1 protein

UniProt

Q8BNQ3

Expression Region

1-385

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAPPWEPVRNDSLPPTLSPAVPPYVKLGLTAVYTVFYALLFVFIYAQLWLVLRYRHKRL SYQSVFLFLCLFWASLRTVLFSFYFRDFVAANSFSPFVFWLLYCFPVCLQFFTLTLMNLY FTQVIFKAKSKYSPELLKYRLPLYLASLFISLVFLLVNLTCAVLVKTGDWDRKVIVSVRV AINDTLFVLCAISLSICLYKISKMSLANIYLESKGSSVCQVTAIGVTVILLYTSRACYNL FILSFSQIKNVHSFDYDWYNVSDQADLKSQLGDAGYVVFGVVLFVWELLPTTLVVYFFRV RNPTKDLTNPGMVPSHGFSPRSYFFDNPRRYDSDDDLAWNIAPQGLQGSFAPDYCDWGQQ NNSFLAQAGTLHQDSTLDPDKASQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human Protein S100-A6 polyclonal Antibody, HRP conjugated
MBS1490509-01 0.05 mg

Rabbit anti-human Protein S100-A6 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human Protein S100-A6 polyclonal Antibody, HRP conjugated
MBS1490509-02 0.1 mg

Rabbit anti-human Protein S100-A6 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human Protein S100-A6 polyclonal Antibody, HRP conjugated
MBS1490509-03 5x 0.1 mg

Rabbit anti-human Protein S100-A6 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rat Monoclonal CD117/c-kit Antibody (2B8) [PE/Cy5.5]
NB100-77477PECY55 0.1 mL

Rat Monoclonal CD117/c-kit Antibody (2B8) [PE/Cy5.5]

Sign In for Pricing
View Details
Human anti-Gal d 2 IgE (M24)
A11B38-M24-E 1 Each

Human anti-Gal d 2 IgE (M24)

Sign In for Pricing
View Details
Btbd6 (NM_001077683) Rat Tagged ORF Clone
RR214756 10 µg

Btbd6 (NM_001077683) Rat Tagged ORF Clone

Sign In for Pricing
View Details