Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Urotensin-2 receptor (Uts2r)

This Recombinant Mouse Urotensin-2 receptor (Uts2r) spans the amino acid sequence from region 1-385.

Product Specifications

Product Name Alternative

Urotensin-2 receptor, UR-2-R, G-protein coupled receptor 14, Urotensin II receptor, UR-II-R

UniProt

Q8VIH9

Expression Region

1-385

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALSLESTSFPMLAVSRSTASELPGGFNVSHNSSWTGPTDPSSLQDLVATGVIGAVLSTM GVVGVVGNVYTLVVMCRFLRASASMYVYVVNLALADLLYLLSIPFIVATYVTKDWHFGDV GCRVLFSLDFLTMHASIFTLTIMSSERYAAVLRPLDTVQRSKGYRKLLALGTWLLALLLT LPMMLAIRLVRRGSKSLCLPAWGPRAHRTYLTLLFGTSIVGPGLVIGLLYIRLARAYWLS QQASFKQTRRLPNPRVLYLILGIVLLFWACFLPFWLWQLLAQYHQAMPLTPETARIINYL TACLTYGNSCINPFLYTLLTKNYREYLRGRQRSLGSSCRGPGSAGSFLSSRVHLQQDSGR SLSSNSQQATETLVLSPVPPNGAFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRFAM7AP1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV758998 1.0 µg DNA

CHRFAM7AP1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Acetyl-L-glutamic acid g-tert-butyl ester 98+% (NMR)
235157-01 1 g

Acetyl-L-glutamic acid g-tert-butyl ester 98+% (NMR)

Sign In for Pricing
View Details
Acetyl-L-glutamic acid g-tert-butyl ester 98+% (NMR)
235157-02 5 g

Acetyl-L-glutamic acid g-tert-butyl ester 98+% (NMR)

Sign In for Pricing
View Details
TOE1 Rabbit pAb
A20801 1000 μL

TOE1 Rabbit pAb

Sign In for Pricing
View Details
MLLT3 Rabbit pAb
E45R30092N-100 100 µL

MLLT3 Rabbit pAb

Sign In for Pricing
View Details
XFD680 Anti-human CD6 Antibody *HI210*
10060190-AAT 100 Tests

XFD680 Anti-human CD6 Antibody *HI210*

Sign In for Pricing
View Details