Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Urotensin-2 receptor (Uts2r)

This Recombinant Mouse Urotensin-2 receptor (Uts2r) spans the amino acid sequence from region 1-385.

Product Specifications

Product Name Alternative

Urotensin-2 receptor, UR-2-R, G-protein coupled receptor 14, Urotensin II receptor, UR-II-R

UniProt

Q8VIH9

Expression Region

1-385

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALSLESTSFPMLAVSRSTASELPGGFNVSHNSSWTGPTDPSSLQDLVATGVIGAVLSTM GVVGVVGNVYTLVVMCRFLRASASMYVYVVNLALADLLYLLSIPFIVATYVTKDWHFGDV GCRVLFSLDFLTMHASIFTLTIMSSERYAAVLRPLDTVQRSKGYRKLLALGTWLLALLLT LPMMLAIRLVRRGSKSLCLPAWGPRAHRTYLTLLFGTSIVGPGLVIGLLYIRLARAYWLS QQASFKQTRRLPNPRVLYLILGIVLLFWACFLPFWLWQLLAQYHQAMPLTPETARIINYL TACLTYGNSCINPFLYTLLTKNYREYLRGRQRSLGSSCRGPGSAGSFLSSRVHLQQDSGR SLSSNSQQATETLVLSPVPPNGAFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhesus Monkey TIM-1/HAVCR1 HEK293 Cell Overexpression Lysate
NHFF-0524-HX787 Each

Rhesus Monkey TIM-1/HAVCR1 HEK293 Cell Overexpression Lysate

Sign In for Pricing
View Details
Rat Endothelial Cell Adhesion Molecule (ESAM) Protein
abx167594-01 10 µg

Rat Endothelial Cell Adhesion Molecule (ESAM) Protein

Sign In for Pricing
View Details
Rat Endothelial Cell Adhesion Molecule (ESAM) Protein
abx167594-02 50 µg

Rat Endothelial Cell Adhesion Molecule (ESAM) Protein

Sign In for Pricing
View Details
Rat Endothelial Cell Adhesion Molecule (ESAM) Protein
abx167594-03 100 µg

Rat Endothelial Cell Adhesion Molecule (ESAM) Protein

Sign In for Pricing
View Details
Rat Endothelial Cell Adhesion Molecule (ESAM) Protein
abx167594-04 200 µg

Rat Endothelial Cell Adhesion Molecule (ESAM) Protein

Sign In for Pricing
View Details
Rat Endothelial Cell Adhesion Molecule (ESAM) Protein
abx167594-05 500 µg

Rat Endothelial Cell Adhesion Molecule (ESAM) Protein

Sign In for Pricing
View Details