Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative gustatory receptor 8a (Gr8a)

This Recombinant Drosophila melanogaster Putative gustatory receptor 8a (Gr8a) spans the amino acid sequence from region 1-385.

Product Specifications

Product Name Alternative

Putative gustatory receptor 8a

UniProt

Q9W367

Expression Region

1-385

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGHLGRVLQFHLRLYQVLGFHGLPLPGDGNPARTRRRLMAWSLFLLISLSALVLACLFS GEEFLYRGDMFGCANDALKYVFAELGVLAIYLETLSSQRHLANFWWLHFKLGGQKTGLVS LRSEFQQFCRYLIFLYAMMAAEVAIHLGLWQFQALTQHMLLFWSTYEPLVWLTYLRNLQF VLHLELLREQLTGLEREMGLLAEYSRFASETGRSFPGFESFLRRRLVQKQRIYSHVYDML KCFQGAFNFSILAVLLTINIRIAVDCYFMYYSIYNNVINNDYYLIVPALLEIPAFIYASQ SCMVVVPRIAHQLHNIVTDSGCCSCPDLSLQIQNFSLQLLHQPIRIDCLGLTILDCSLLT RMACSVGTYMIYSIQFIPKFSNTYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GEF H1 Rabbit Polyclonal Antibody (Cy3)
orb982053 100 µL

GEF H1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
DiagPoly™ Plain Polystyrene Particles, 50 µm
DMP-L061 0.5 g

DiagPoly™ Plain Polystyrene Particles, 50 µm

Sign In for Pricing
View Details
Recombinant Human CD177 Protein, N-His
orb3060760-01 50 µg

Recombinant Human CD177 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD177 Protein, N-His
orb3060760-02 100 µg

Recombinant Human CD177 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD177 Protein, N-His
orb3060760-03 1 mg

Recombinant Human CD177 Protein, N-His

Sign In for Pricing
View Details
CDHF10 discontinued
342426-01 100 µL

CDHF10 discontinued

Sign In for Pricing
View Details