Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuropeptide Y receptor type 2 (Npy2r)

This Recombinant Mouse Neuropeptide Y receptor type 2 (Npy2r) spans the amino acid sequence from region 1-385.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 2, NPY2-R, NPY-Y2 receptor, Y2 receptor

UniProt

P97295

Expression Region

1-385

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLKMGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQVILILA YCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEW KMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGIS ALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIIS FSYTRIWSKLRNHVSPGAASDHYHQRRHKMTKMLVCVVVVFAVSWLPLHAFQLAVDIDSH VLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMT FKAKKNLEVKKNNGPTDSFSEATNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD99 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D5]
TA800824BM 100 µL

CD99 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D5]

Sign In for Pricing
View Details
SMURF1 (NM_181349) Human Recombinant Protein
TP319536 20 µg

SMURF1 (NM_181349) Human Recombinant Protein

Sign In for Pricing
View Details
ZNF96 (ZSCAN12) Rabbit Polyclonal Antibody
TA365409 100 µL

ZNF96 (ZSCAN12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Helicobacter pylori (HP/1336), Biotin conjugate, 0.1mg/mL
BNCB1336-500 1x 500 µL

Helicobacter pylori (HP/1336), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-(Benzylthio)-4-chlorobenzoic Acid
TRC-B315030-250MG 250 mg

2-(Benzylthio)-4-chlorobenzoic Acid

Sign In for Pricing
View Details
FNDC8 (Center) Rabbit Polyclonal Antibody
AP51693PU-N 400 µL

FNDC8 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details