Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adiponectin receptor protein 2 (ADIPOR2)

This Recombinant Human Adiponectin receptor protein 2 (ADIPOR2) spans the amino acid sequence from region 1-386.

Product Specifications

Product Name Alternative

Adiponectin receptor protein 2, Progestin and adipoQ receptor family member II

UniProt

Q86V24

Expression Region

1-386

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSE EHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDF LLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQE KVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFY CNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAF VHFHGVSNLQEFRFMIGGGCSEEDAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTRF1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]
TA813065BM 100 µL

MTRF1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]

Sign In for Pricing
View Details
Albumin Antibody
KC-177-01 50 μL

Albumin Antibody

Sign In for Pricing
View Details
Albumin Antibody
KC-177-02 100 µL

Albumin Antibody

Sign In for Pricing
View Details
Albumin Antibody
KC-177-03 1 mL

Albumin Antibody

Sign In for Pricing
View Details
PFKFB1 (N-term) Rabbit Polyclonal Antibody
AP15140PU-N 400 µL

PFKFB1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]
AN00428UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]

Sign In for Pricing
View Details