Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adiponectin receptor protein 2 (Adipor2)

This Recombinant Mouse Adiponectin receptor protein 2 (Adipor2) spans the amino acid sequence from region 1-386.

Product Specifications

Product Name Alternative

Adiponectin receptor protein 2

UniProt

Q8BQS5

Expression Region

1-386

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEPAKHRLGCTRTPEPDIRLRKGHQLDDTRGSNNDNYQGDLEPSLETPVCSSYYENSPE EPECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWRVIPHDVLPDWLKDNDF LLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQE KVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFY CNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFVGLGLSGIIPTLHYVISE GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAF VHFHGVSNLQEFRFMIGGGCTEEDAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dry Bath Incubator BDIB-105
BDIB-105 1 Unit

Dry Bath Incubator BDIB-105

Sign In for Pricing
View Details
THUMPD3 (Center) Rabbit Polyclonal Antibody
AP54245PU-N 400 µL

THUMPD3 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl 4-Bromoacetoacetate
TRC-E900590-5G 5 g

Ethyl 4-Bromoacetoacetate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS640088 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
ReadiLink™ Rapid mFluor™ Violet 610 Antibody Labeling Kit *Microscale Optimized for Labeling 50 µg Antibody Per Reaction*
1116-AAT 2 Labelings

ReadiLink™ Rapid mFluor™ Violet 610 Antibody Labeling Kit *Microscale Optimized for Labeling 50 µg Antibody Per Reaction*

Sign In for Pricing
View Details
DNAJA2 (NM_005880) Human Over-expression Lysate
LC401779 20 µg

DNAJA2 (NM_005880) Human Over-expression Lysate

Sign In for Pricing
View Details