Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adiponectin receptor protein 2 (Adipor2)

This Recombinant Mouse Adiponectin receptor protein 2 (Adipor2) spans the amino acid sequence from region 1-386.

Product Specifications

Product Name Alternative

Adiponectin receptor protein 2

UniProt

Q8BQS5

Expression Region

1-386

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEPAKHRLGCTRTPEPDIRLRKGHQLDDTRGSNNDNYQGDLEPSLETPVCSSYYENSPE EPECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWRVIPHDVLPDWLKDNDF LLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQE KVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFY CNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFVGLGLSGIIPTLHYVISE GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAF VHFHGVSNLQEFRFMIGGGCTEEDAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2A Bbd (H2AFB2) (NM_001017991) Human Over-expression Lysate
LY422230 100 µg

Histone H2A Bbd (H2AFB2) (NM_001017991) Human Over-expression Lysate

Sign In for Pricing
View Details
Glycoprotein 2 (GP2) (NM_001007242) Human Over-expression Lysate
LY423464 100 µg

Glycoprotein 2 (GP2) (NM_001007242) Human Over-expression Lysate

Sign In for Pricing
View Details
AGPAT7 (LPCAT4) Rabbit Polyclonal Antibody
TA371152 100 µL

AGPAT7 (LPCAT4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MGMT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G6]
TA809195AM 100 µL

MGMT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G6]

Sign In for Pricing
View Details
Vertical Laminar Airflow BLVR-201
BLVR-201 1 Unit

Vertical Laminar Airflow BLVR-201

Sign In for Pricing
View Details
GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI6A6]
CF811963 100 µg

GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI6A6]

Sign In for Pricing
View Details