Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana 4-hydroxybenzoate polyprenyltransferase, mitochondrial (PPT1)

This Recombinant Arabidopsis thaliana 4-hydroxybenzoate polyprenyltransferase, mitochondrial (PPT1) spans the amino acid sequence from region 22-407.

Product Specifications

Product Name Alternative

4-hydroxybenzoate polyprenyltransferase, mitochondrial, 4HPT, EC= 2.5.1.39, 4-hydroxybenzoate nonaprenyltransferase, Polyprenyltransferase 1, AtPPT1

UniProt

Q93YP7

Expression Region

22-407

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PSSSSALLQSQHKSLSNPVTTHYTNPFTKCYPSWNDNYQVWSKGRELHQEKFFGVGWNYR LICGMSSSSSVLEGKPKKDDKEKSDGVVVKEASWIDLYLPEEVRGYAKLARLDKPIGTWL LAWPCMWSIALAADPGSLPSFKYMALFGCGALLLRGAGCTINDLLDQDIDTKVDRTKLRP IASGLLTPFQGIGFLGLQLLLGLGILLQLNNYSRVLGASSLLLVFSYPLMKRFTFWPQAF LGLTINWGALLGWTAVKGSIAPSIVLPLYLSGVCWTLVYDTIYAHQDKEDDVKVGVKSTA LRFGDNTKLWLTGFGTASIGFLALSGFSADLGWQYYASLAAASGQLGWQIGTADLSSGAD CSRKFVSNKWFGAIIFSGVVLGRSFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-100 1x 100 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF640R conjugate, 0.1mg/mL
BNC400032-100 1x 100 µL

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF640R conjugate, 0.1mg/mL
BNC402110-100 1x 100 µL

PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/195), CF740 conjugate, 0.1mg/mL
BNC740195-100 1x 100 µL

CD66 (CEA) (C66/195), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bax (2D2), CF405S conjugate, 0.1mg/mL
BNC040004-100 1x 100 µL

Bax (2D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (2755-8), CF568 conjugate, 0.1mg/mL
BNC680091-100 1x 100 µL

Fibronectin (2755-8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details