Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Proteinase-activated receptor 1 (F2R)

This Recombinant Bovine Proteinase-activated receptor 1 (F2R) spans the amino acid sequence from region 42-427.

Product Specifications

Product Name Alternative

Proteinase-activated receptor 1, PAR-1, Thrombin receptor

UniProt

A7YY44

Expression Region

42-427

Origin

Bos taurus (Bovine)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SFFLRNSNDGYEQIPLPEDEDSSEGEFTEDRLSSGNRSSPPQKSPPGFISKSASGYLTSA WLTVFIPSVYTGVFLVSLPLNIMAVVVFVLKMKVKKPAVVYMLHLAAADVLFVCVLPFKI SYYFSGSDWRFGSAMCRFVTAAFYGNMYASIMLMTAISVDRFLAVVYPIQSLSWRTLGRA SFICLAIWAMAIAGVAPLLLQEQATQVPGLNITACHDVLNQTLLEGYYSYYFSAFSAVFF FVPLTLSTVSYVSIIRCLSSSTVANQNKKSRALLLSAAVFCIFILCFGPTNILLLLHYAF LSSDPMTEAAYFAYLLCVCVSSISCCIDPLIYYYASSECQRHLFAILHCKESSDPGSCNS SGQLMPSKMDTCSSNLSSSLYKKLLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
BNC940034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF740 conjugate, 0.1mg/mL
BNC740322-100 1x 100 µL

CD3e (RIV9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
BNC470158-500 1x 500 µL

Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-500 1x 500 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details