Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus griseus 5-hydroxytryptamine receptor 1B (HTR1B)

This Recombinant Cricetulus griseus 5-hydroxytryptamine receptor 1B (HTR1B) spans the amino acid sequence from region 1-386.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1B, 5-HT-1B, 5-HT1B, Serotonin receptor 1B

UniProt

P46636

Expression Region

1-386

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEQGIQCAPPPPAASQTGVPLVNLSHNCSAESHIYQDSIALPWKVLLVALLALITLATT LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPVSTMYTVTGRWTLGQVVCDF WLSSDITCCTASIMHLCVIALDRYWAITDAVEYAAKRTPKRAAIMIALVWVFSISISLPP FFWRQAKAEEEVLTCLVNTDHVLYTVYSTGGAFYLPTLLLIALYGRIYVEARSRILKQTP NKTGKRLTRAQLITDSPGSTTSVTSINSRAPDLPSESGSPVYVNQVKVRVSDALLEKKKL MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMATLDFFNWLGYLNSLI NPIIYTMSNEDFKQAFHKLIRFKCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC12A6 (NM_001042495) Human Tagged ORF Clone
RC209880 10 µg

SLC12A6 (NM_001042495) Human Tagged ORF Clone

Sign In for Pricing
View Details
Protein Kinase C zeta (PKCz) (Not for Export EU)
P9103-72B 100 µL

Protein Kinase C zeta (PKCz) (Not for Export EU)

Sign In for Pricing
View Details
Vmn1r209 (NM_001013787) Mouse Untagged Clone
MC214942 10 µg

Vmn1r209 (NM_001013787) Mouse Untagged Clone

Sign In for Pricing
View Details
Human GDF2 ELISA Kit
ELA-E1728h 96 Tests

Human GDF2 ELISA Kit

Sign In for Pricing
View Details
Recombinant Bordetella bronchiseptica UPF0337 protein BB3586 (BB3586)
MBS1441232-01 0.02 mg (E-Coli)

Recombinant Bordetella bronchiseptica UPF0337 protein BB3586 (BB3586)

Sign In for Pricing
View Details
Recombinant Bordetella bronchiseptica UPF0337 protein BB3586 (BB3586)
MBS1441232-02 0.1 mg (E-Coli)

Recombinant Bordetella bronchiseptica UPF0337 protein BB3586 (BB3586)

Sign In for Pricing
View Details