Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus griseus 5-hydroxytryptamine receptor 1B (HTR1B)

This Recombinant Cricetulus griseus 5-hydroxytryptamine receptor 1B (HTR1B) spans the amino acid sequence from region 1-386.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1B, 5-HT-1B, 5-HT1B, Serotonin receptor 1B

UniProt

P46636

Expression Region

1-386

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEQGIQCAPPPPAASQTGVPLVNLSHNCSAESHIYQDSIALPWKVLLVALLALITLATT LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPVSTMYTVTGRWTLGQVVCDF WLSSDITCCTASIMHLCVIALDRYWAITDAVEYAAKRTPKRAAIMIALVWVFSISISLPP FFWRQAKAEEEVLTCLVNTDHVLYTVYSTGGAFYLPTLLLIALYGRIYVEARSRILKQTP NKTGKRLTRAQLITDSPGSTTSVTSINSRAPDLPSESGSPVYVNQVKVRVSDALLEKKKL MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMATLDFFNWLGYLNSLI NPIIYTMSNEDFKQAFHKLIRFKCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human AIF ELISA Kit (Chemiluminescence)
NBP2-66673 1 Kit

Human AIF ELISA Kit (Chemiluminescence)

Sign In for Pricing
View Details
EYA1 (NM_172059) Human Tagged ORF Clone
RG218031 10 µg

EYA1 (NM_172059) Human Tagged ORF Clone

Sign In for Pricing
View Details
AFAP Overexpression Lysate (Native) - (Dry Ice)
NBL1-07367 0.1 mg

AFAP Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
HIP1R siRNA (Human)
MBS829444-01 15 nmol

HIP1R siRNA (Human)

Sign In for Pricing
View Details
HIP1R siRNA (Human)
MBS829444-02 30 nmol

HIP1R siRNA (Human)

Sign In for Pricing
View Details
HIP1R siRNA (Human)
MBS829444-03 5x 30 nmol

HIP1R siRNA (Human)

Sign In for Pricing
View Details