Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Amblysomus hottentotus Alpha-2B adrenergic receptor (ADRA2B)

This Recombinant Amblysomus hottentotus Alpha-2B adrenergic receptor (ADRA2B) spans the amino acid sequence from region 1-386.

Product Specifications

Product Name Alternative

Alpha-2B adrenergic receptor, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR

UniProt

O18935

Expression Region

1-386

Origin

Amblysomus hottentotus (Hottentot golden mole)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFRHMWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCII LTVWLIAAAISLPPLIYKGDQGPQPHGRPQCKLNQEAWYILSSSIGSFFAPCLIMILVYL RIYLIAKRSNRRGPRAKGATREGESKLPHPMAAGASASAKPPTLTSSLAVAGEANGHSKP TGEEGETLEDPVTSTLPPSWPALPNSDQGQKEGVCETSPEEDDEEEECGPQAVPVSPASA GSPPLQQPQGSRVLATLRGQVLLGRGVGAAGGQWWRRRTQLTREKRFTFVLAVVIGVFVL CWFPFFFSYSLGAICPQHCKVPHGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
BNC051429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
BNC680218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-100 1x 100 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-500 1x 500 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF647 conjugate, 0.1mg/mL
BNC470164-100 1x 100 µL

CD28 (204.12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details