Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Probable G-protein coupled receptor 173 (gpr173)

This Recombinant Danio rerio Probable G-protein coupled receptor 173 (gpr173) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 173, Super conserved receptor expressed in brain 3

UniProt

Q9I918

Expression Region

1-387

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANGNASSDGPGNPLAAVVSTTGGVMGGAPSSAVSTYVKLVLLGLIICISLVGNLVVSLL VLRDRALHKAPYYFLLDLCLADTIRSAVCFPFVLVSIKNGSAWTYSVLSCKVVAFMAVLF CFHAAFMLFCISVTRYMAIAHHRFYSKRMTFWTCVAVVCMVWTLSVAMAFPPVFDVGTYK FIREEDQCIFEHRYFKANDTLGFMLMLAVLILATHVVYMKLLLFEYKHRKMKPVQMVPAI SQNWTFHGPGATGQAAANWIAGFGRGPMPPTLLGIRQNLHNQNRRLLGMEEFKAEKQLGR MFYVITLFFLVLWSPYIVACYWRVFVKACTIPHRYLSTTVWMSFAQAGVNPIICFFLNKD LKKGLLAHLPPCCRTPPQLPREPYCVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-500 1x 500 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-500 1x 500 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC470525-500 1x 500 µL

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL
BNC040630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (HSPB1/774), CF770 conjugate, 0.1mg/mL
BNC700774-100 1x 100 µL

HSP27 (HSPB1/774), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2 + ICO-106), CF568 conjugate, 0.1mg/mL
BNC680735-500 1x 500 µL

Human Lambda Light Chain (LcN-2 + ICO-106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details