Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat D (4) dopamine receptor (Drd4)

This Recombinant Rat D (4) dopamine receptor (Drd4) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

D (4) dopamine receptor, D (2C) dopamine receptor, Dopamine D4 receptor

UniProt

P30729

Expression Region

1-387

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNSSATGDGGLLAGRGPESLGTGTGLGGAGAAALVGGVLLIGMVLAGNSLVCVSVASER ILQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASI FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVAAPVVCGLNDVPGRDPTVC CLEDRDYVVYSSICSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV SDPTQGPLFSDCPPPSPSLRTSPTVSSRPESDLSQSPCSPGCLLPDAALAQPPAPSSRRK RGAKITGRERKAMRVLPVVVGAFLMCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN SALNPIIYTIFNAEFRSVFRKTLRLRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OAEC04359-100UL - NPPB Antibody
OAEC04359-100UL 100 µg / 100 µL

OAEC04359-100UL - NPPB Antibody

Sign In for Pricing
View Details
Mouse Prdx1 (Peroxiredoxin-1) ELISA Kit
EM0743 96 Tests

Mouse Prdx1 (Peroxiredoxin-1) ELISA Kit

Sign In for Pricing
View Details
P130 Cas Polyclonal Antibody
ABP52095-01 30 µL

P130 Cas Polyclonal Antibody

Sign In for Pricing
View Details
P130 Cas Polyclonal Antibody
ABP52095-02 100 µL

P130 Cas Polyclonal Antibody

Sign In for Pricing
View Details
P130 Cas Polyclonal Antibody
ABP52095-03 200 µL

P130 Cas Polyclonal Antibody

Sign In for Pricing
View Details
Polyclonal Antibody to Interferon Regulatory Factor 3 (IRF3)
TRV-0057734-01 20 µL

Polyclonal Antibody to Interferon Regulatory Factor 3 (IRF3)

Sign In for Pricing
View Details