Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat D (4) dopamine receptor (Drd4)

This Recombinant Rat D (4) dopamine receptor (Drd4) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

D (4) dopamine receptor, D (2C) dopamine receptor, Dopamine D4 receptor

UniProt

P30729

Expression Region

1-387

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNSSATGDGGLLAGRGPESLGTGTGLGGAGAAALVGGVLLIGMVLAGNSLVCVSVASER ILQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASI FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVAAPVVCGLNDVPGRDPTVC CLEDRDYVVYSSICSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV SDPTQGPLFSDCPPPSPSLRTSPTVSSRPESDLSQSPCSPGCLLPDAALAQPPAPSSRRK RGAKITGRERKAMRVLPVVVGAFLMCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN SALNPIIYTIFNAEFRSVFRKTLRLRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Calponin 3 (CNN3) ELISA kit
GTR10467499 96 Well

Mouse Calponin 3 (CNN3) ELISA kit

Sign In for Pricing
View Details
Pias2 (NM_001164168) Mouse Tagged Lenti ORF Clone
MR209412L4 10 µg

Pias2 (NM_001164168) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human PLLP shRNA (UAS) - Lentiviral human PLLP shRNA (UAS) (25)
GTR15111053 1 Vial

Lentiviral human PLLP shRNA (UAS) - Lentiviral human PLLP shRNA (UAS) (25)

Sign In for Pricing
View Details
Mouse Monoclonal Doublecortin Antibody (3E1) [DyLight 755]
NBP1-92684IR 0.1 mL

Mouse Monoclonal Doublecortin Antibody (3E1) [DyLight 755]

Sign In for Pricing
View Details
Chicken V-Set and Transmembrane Domain-Containing Protein 2A (VSTM2A) ELISA Kit
MBS9923389 Inquire

Chicken V-Set and Transmembrane Domain-Containing Protein 2A (VSTM2A) ELISA Kit

Sign In for Pricing
View Details
IgG Isotype Control antibody
MBS832485-01 0.05 mg

IgG Isotype Control antibody

Sign In for Pricing
View Details