Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse D (4) dopamine receptor (Drd4)

This Recombinant Mouse D (4) dopamine receptor (Drd4) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

D (4) dopamine receptor, D (2C) dopamine receptor, Dopamine D4 receptor

UniProt

P51436

Expression Region

1-387

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNSSATEDGGLLAGRGPESLGTGAGLGGAGAAALVGGVLLIGLVLAGNSLVCVSVASER TLQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASI FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVASPVVCGLNDVPGRDPAVC CLENRDYVVYSSVCSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV SDPTQGPFFPDCPPPLPSLRTSPSDSSRPESELSQRPCSPGCLLADAALPQPPEPSSRRR RGAKITGRERKAMRVLPVVVGAFLVCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN SALNPIIYTIFNAEFRSVFRKTLRLRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS36 Antibody
orb687208-01 50 μL

VPS36 Antibody

Sign In for Pricing
View Details
VPS36 Antibody
orb687208-02 100 µL

VPS36 Antibody

Sign In for Pricing
View Details
Mgst3 Rat Pre-designed siRNA Set A
HY-RS28164 1 Set

Mgst3 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Fibroblast Growth Factor 6 (FGF6) Human ELISA Kit
D4091 96 Tests

Fibroblast Growth Factor 6 (FGF6) Human ELISA Kit

Sign In for Pricing
View Details
Hsa-miR-6791-3p miRNA Agomir
CMJ2246-01 5 nmol

Hsa-miR-6791-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-6791-3p miRNA Agomir
CMJ2246-02 10 nmol

Hsa-miR-6791-3p miRNA Agomir

Sign In for Pricing
View Details