Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse D (4) dopamine receptor (Drd4)

This Recombinant Mouse D (4) dopamine receptor (Drd4) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

D (4) dopamine receptor, D (2C) dopamine receptor, Dopamine D4 receptor

UniProt

P51436

Expression Region

1-387

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNSSATEDGGLLAGRGPESLGTGAGLGGAGAAALVGGVLLIGLVLAGNSLVCVSVASER TLQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASI FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVASPVVCGLNDVPGRDPAVC CLENRDYVVYSSVCSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV SDPTQGPFFPDCPPPLPSLRTSPSDSSRPESELSQRPCSPGCLLADAALPQPPEPSSRRR RGAKITGRERKAMRVLPVVVGAFLVCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN SALNPIIYTIFNAEFRSVFRKTLRLRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cstf2 shRNA (UAS) - Lentiviral mouse Cstf2 shRNA (UAS, iRFP) (25)
GTR15161294 1 Vial

Lentiviral mouse Cstf2 shRNA (UAS) - Lentiviral mouse Cstf2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ADRA1A Antibody
orb1557663-01 50 μL

ADRA1A Antibody

Sign In for Pricing
View Details
ADRA1A Antibody
orb1557663-02 100 µL

ADRA1A Antibody

Sign In for Pricing
View Details
ADRA1A Antibody
orb1557663-03 200 µL

ADRA1A Antibody

Sign In for Pricing
View Details
Mouse Psmd13 Pre-designed siRNA Set A
SI111330A 1 Each

Mouse Psmd13 Pre-designed siRNA Set A

Sign In for Pricing
View Details
JAK2(Phospho Tyr931) Polyclonal Antibody
JOT-AP10561-01 20 µL

JAK2(Phospho Tyr931) Polyclonal Antibody

Sign In for Pricing
View Details