Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galanin receptor type 2 (GALR2)

This Recombinant Human Galanin receptor type 2 (GALR2) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Galanin receptor type 2, GAL2-R, GALR-2

UniProt

O43603

Expression Region

1-387

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ PCILEPCPGPSWQGPKAGDSILTVDVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrrc4 Mouse Monoclonal Antibody [Clone ID: N50/36]
75-084 100 µL

Lrrc4 Mouse Monoclonal Antibody [Clone ID: N50/36]

Sign In for Pricing
View Details
ENT1 (SLC29A1) Rabbit Polyclonal Antibody
TA361211 100 µL

ENT1 (SLC29A1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Noggin (NOG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C12]
TA500028BM 100 µL

Noggin (NOG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C12]

Sign In for Pricing
View Details
PLK4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D12]
TA810507BM 100 µL

PLK4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D12]

Sign In for Pricing
View Details
C4BPB (NM_001017364) Human Over-expression Lysate
LC422638 20 µg

C4BPB (NM_001017364) Human Over-expression Lysate

Sign In for Pricing
View Details
S100a14 Mouse Gene Knockout Kit (CRISPR)
KN515234 1 Kit

S100a14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details