Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galanin receptor type 2 (GALR2)

This Recombinant Human Galanin receptor type 2 (GALR2) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Galanin receptor type 2, GAL2-R, GALR-2

UniProt

O43603

Expression Region

1-387

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ PCILEPCPGPSWQGPKAGDSILTVDVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal p27/Kip1 Antibody (SX53G8) [FITC]
NBP2-34718F 0.1 mL

Mouse Monoclonal p27/Kip1 Antibody (SX53G8) [FITC]

Sign In for Pricing
View Details
70nm Stabilized Gold Nanoparticles
CG-70-500-10 500 mL

70nm Stabilized Gold Nanoparticles

Sign In for Pricing
View Details
Amyloid Precursor Protein (APP, Amyloid beta (A4) Precursor Protein)
A2275-69 100 µL

Amyloid Precursor Protein (APP, Amyloid beta (A4) Precursor Protein)

Sign In for Pricing
View Details
LOX Rabbit Polyclonal Antibody
TA321470 100 µL

LOX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Varicella-zoster virus Membrane protein 0 (ORF0)
orb2928908-01 20 µg

Recombinant Varicella-zoster virus Membrane protein 0 (ORF0)

Sign In for Pricing
View Details
Recombinant Varicella-zoster virus Membrane protein 0 (ORF0)
orb2928908-02 100 µg

Recombinant Varicella-zoster virus Membrane protein 0 (ORF0)

Sign In for Pricing
View Details