Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galanin receptor type 2 (GALR2)

This Recombinant Human Galanin receptor type 2 (GALR2) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Galanin receptor type 2, GAL2-R, GALR-2

UniProt

O43603

Expression Region

1-387

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ PCILEPCPGPSWQGPKAGDSILTVDVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp638 (NM_001166371) Mouse Tagged ORF Clone
MR211880 10 µg

Zfp638 (NM_001166371) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Efrapeptin F
orb1738489-01 50 mg

Efrapeptin F

Sign In for Pricing
View Details
Efrapeptin F
orb1738489-02 100 mg

Efrapeptin F

Sign In for Pricing
View Details
Efrapeptin F
orb1738489-03 25 mg

Efrapeptin F

Sign In for Pricing
View Details
Vmn2r44 Mouse shRNA Lentiviral Particle (Locus ID 434113)
TL518606V 500 µL Each

Vmn2r44 Mouse shRNA Lentiviral Particle (Locus ID 434113)

Sign In for Pricing
View Details
Lentiviral mouse Fnip1 shRNA (UAS) - Lentiviral mouse Fnip1 shRNA (UAS, iRFP) (100)
GTR15283983 1 Vial

Lentiviral mouse Fnip1 shRNA (UAS) - Lentiviral mouse Fnip1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details